Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---------------MLKISYKPSTDSKEMKKEYET-VNDFLQ-GQYLEV---PPLQDHFVVTTV----------TLDGKEIEMP-DQTISG-LFNYFNK----------------------------- 3CWX Chain:A ((47-176)) EVNPDIIKDEVFDFVIVNRVLKKIKD----LKHYDPMIEKIFEMGLNVEIQINPEVKDFFTFKSISTTNKQRCFLSLRGETREILCDNKLYNMLLAVFNSYDPNDLLKHISTVESLKKIFYTITCEAVY

General information: TITO was launched using: RESULT: Template: 3CWX.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 208 10531 50.63 164.55 target 2D structure prediction score : 0.36 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : 50.63 2D Compatibility (Sec. Struct. Predict.) : 0.36 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.476

(partial model without unconserved sides chains): PDB file : Tito_3CWX.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3CWX-query.scw PDB file : Tito_Scwrl_3CWX.pdb: