Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAKKIDGYIKLQVPAGKANPSPPIGPALGQRGVNIMAFCKEFNAATQKVEPGLPIPVVITVYNDKSFTFIMKTPPASILLKKAAGIQKGSSVPNKTKVGKLTRAQLEEIATTKEPDLTGADLDARVRTIAGSARSMGLEVEL 3EGV Chain:B ((1-77)) --KKVVAVVKLQLPAGAATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAI-VPVEITIYADRSFTFVTKTPPASYLI--------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3EGV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 310 -62582 -201.88 -812.75 target 2D structure prediction score : 0.79 Monomeric hydrophicity matching model chain B : 0.74 3D Compatibility (PKB) : -201.88 2D Compatibility (Sec. Struct. Predict.) : 0.79 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.736

(partial model without unconserved sides chains): PDB file : Tito_3EGV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3EGV-query.scw PDB file : Tito_Scwrl_3EGV.pdb: