Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GGRKPEPWT--------AEQKANMIALSRSTLSRPRCNIIIYGLPSGRNQDRPVMGEADTALNSEVFITVRSGEKYRCTVKDDCDKPTCHELPPHLTYAGTDMHAIPLVT-LRSLGVEIN----------------------------------------
5FZP Chain:A ((2-345))DSTSGWRAPSCTKVTGDGAVTFTTDDGATLAPTTGTLQSVSYTHGLVALDTPNTLLATHNDELQRSTDAGCTWTKVATLGSGSTWLTAATGGRAFAWEKNGGYLARVDGRTVTKLSSPSADIVGVGTDKARRDHVRLAGSDGQLYDSTDAGATWKPLGKLAFGPGASVYTVSFDPADLDHAVAGGMTTGGAVTTDGGAT---WTAATGLSATAGGKSNLFAASVSPADRN----VVYALGIDLVEAAPNSGAEG----RHLYRSTDGGRTYTRIVDDTPDTELTNSTLLAPSPVDPNVLYFEYGTYFQAYGTDLYRYDARTGKVGKTHNAHDGISAIAFNPARPSVMYLGLEEVQ


General information:
TITO was launched using:
RESULT:

Template: 5FZP.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 422 24391 57.80 243.91
target 2D structure prediction score : 0.63
Monomeric hydrophicity matching model chain A : 0.57

3D Compatibility (PKB) : 57.80
2D Compatibility (Sec. Struct. Predict.) : 0.63
1D Compatibility (Hydrophobicity) : 0.57
QMean score : 0.376

(partial model without unconserved sides chains):
PDB file : Tito_5FZP.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5FZP-query.scw
PDB file : Tito_Scwrl_5FZP.pdb: