Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----MSKNIVQLNNSFIQNEYQRRRYLMKERQKRNRFMGGVLILIM-----LLFILPTFNLAQSYQQLLQRRQQLADLQTQYQTLSDEKDKETAFATKLKDEDYAAKYTRAKYYYSKSREKVYTIPDLLQR--------
4YHV Chain:A ((11-145))EKPTVYHCKVFQFKN--LQNPKIRFKLKMNSKELS---LKGLCLRIRDDGPGIIIVVGNEKSCKFYENLVMKRIKWNEDFELHTNTGDIKMDMHNNSISKTWEGYLQDCKFKGWFMKVCNDQDSLLRTLGQFDSEHFYSP


General information:
TITO was launched using:
RESULT:

Template: 4YHV.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 488 13000 26.64 111.11
target 2D structure prediction score : 0.35
Monomeric hydrophicity matching model chain A : 0.64

3D Compatibility (PKB) : 26.64
2D Compatibility (Sec. Struct. Predict.) : 0.35
1D Compatibility (Hydrophobicity) : 0.64
QMean score : 0.174

(partial model without unconserved sides chains):
PDB file : Tito_4YHV.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4YHV-query.scw
PDB file : Tito_Scwrl_4YHV.pdb: