Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------------------------------------------------------------------------------------------------------MELAETSIVKKNHQIPCIINQKIAQKLIEKTSMTDIDHQLSI-STSTVIRKINNFHFEHDFSRLPEIMS------------------- 5M1P Chain:A ((3-189)) AMNSVFSGLDMLILLPYERRGTRLVVEDYRPDHIYCIGADFGKNQDYSVFSVLDLDTGAIACLERMNGATWSDQVARLKALSEDYGHAYVVADTWGVGDAIAEELDAQGI---NYTPLPVKSSSVKEQLISNLALLMEKGQVAVPNDKTILDELRNFRYYRTASGNQVMRAYGRGHDDIVMSLALAYSQY

General information: TITO was launched using: RESULT: Template: 5M1P.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 168 5836 34.74 89.78 target 2D structure prediction score : 0.49 Monomeric hydrophicity matching model chain A : 0.54 3D Compatibility (PKB) : 34.74 2D Compatibility (Sec. Struct. Predict.) : 0.49 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.402

(partial model without unconserved sides chains): PDB file : Tito_5M1P.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5M1P-query.scw PDB file : Tito_Scwrl_5M1P.pdb: