Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------MLNLQFAETMELTEAELQDVRGGNLVNSMGGGGRSGISGWGV--PGIYPGWGNQGMSPNRGAFDWT-----IDLADGLFGRRRR
5T51 Chain:B ((13-102))EHIRFQRLVQVCNKALEESIRKLQSWEKIHECFPNYGQTREGIENLTVCQQQVIKLWSNLSRVEFDAIFHERSIEEKLNQLDDLINKARS


General information:
TITO was launched using:
RESULT:

Template: 5T51.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 119 1425 11.97 18.51
target 2D structure prediction score : 0.31
Monomeric hydrophicity matching model chain B : 0.66

3D Compatibility (PKB) : 11.97
2D Compatibility (Sec. Struct. Predict.) : 0.31
1D Compatibility (Hydrophobicity) : 0.66
QMean score : -0.180

(partial model without unconserved sides chains):
PDB file : Tito_5T51.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5T51-query.scw
PDB file : Tito_Scwrl_5T51.pdb: