Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSRVRVQIMNQFHRKSHEYKAIKRYWKLIQQDSRKLSDKRFYRPTFRMHLTNKEILDKILSYSEDLKHHYQIYQLLLFHFQNKDPEKFFGLIEDNLKQVHPIFQTVFKTFLKNKEKIVNALQLPYSNAKIGSDQ 2DII Chain:A ((17-34)) -----------------------------------------------------EEKNRMLQEDPVLFQLYK---------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2DII.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 12 -3329 -277.42 -184.94 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.55 3D Compatibility (PKB) : -277.42 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.843

(partial model without unconserved sides chains): PDB file : Tito_2DII.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2DII-query.scw PDB file : Tito_Scwrl_2DII.pdb: