Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------MGDKPISFRDADGNFVSAADVWNEKKLEELFNRLNPNRALRLARTTKENPSQ-----------------------------------------------------------------------------------------------------------------
2ND4 Chain:A ((1-173))GENPSASNQLIQKKYVSWRDAADEANTQVAAHEAEIKEETLRQ--PGVVAAQQALDKANAIVGHDHEQAVKRAQEDYNTAYNEAYNTVRNRYIQVLQQKYIEAAKAQGNYYDETAVEANRTNEQRIADDIKAQTGKDVTVTKDENGNYVVKDEKGNVVATVDKDGKTVKADAKAG


General information:
TITO was launched using:
RESULT:

Template: 2ND4.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 71 3988 56.17 79.76
target 2D structure prediction score : 0.58
Monomeric hydrophicity matching model chain A : 0.64

3D Compatibility (PKB) : 56.17
2D Compatibility (Sec. Struct. Predict.) : 0.58
1D Compatibility (Hydrophobicity) : 0.64
QMean score : 0.424

(partial model without unconserved sides chains):
PDB file : Tito_2ND4.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2ND4-query.scw
PDB file : Tito_Scwrl_2ND4.pdb: