Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSKVCQVTGKRPVVGNNVSHANNKTKRRFEPNLHHHRFWLESEKRFVRLRLTTKGMRIIDKLGIEKVVADLRAQGQKI 5X8T Chain:Y ((72-145)) -RRICPFTGKKSNKANRVSHSNHKTKRLQFVNLQYKRVWWEAGKRFVKLRLSTKALKTIEKNGLDAVAKKAGIDL---

General information: TITO was launched using: RESULT: Template: 5X8T.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain Y - contact count / total energy / energy per contact / energy per residue : 245 -19321 -78.86 -261.09 target 2D structure prediction score : 0.62 Monomeric hydrophicity matching model chain Y : 0.81 3D Compatibility (PKB) : -78.86 2D Compatibility (Sec. Struct. Predict.) : 0.62 1D Compatibility (Hydrophobicity) : 0.81 QMean score : 0.494

(partial model without unconserved sides chains): PDB file : Tito_5X8T.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5X8T-query.scw PDB file : Tito_Scwrl_5X8T.pdb: