Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDIDAISKALANPLRRQILQWLKEPEHYLPVEECGGSFEKGVCAGHIERLGKVAQSTMSNHLSVLQQAGLIQVQKYGQWSYFSRNEALIQQYIEHLKQTL 3PQK Chain:C ((26-104)) ---ANLLKTLSHPVRLMLVCTLV---------------EGEFSVGELEQQIGIGQPTLSQQLGVLRESGIVETRRNIKQIFYRLTEAKAAQLVNALY---

General information: TITO was launched using: RESULT: Template: 3PQK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 268 -58118 -216.86 -735.67 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain C : 0.72 3D Compatibility (PKB) : -216.86 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.582

(partial model without unconserved sides chains): PDB file : Tito_3PQK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3PQK-query.scw PDB file : Tito_Scwrl_3PQK.pdb: