Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNEKKQSRLRRAKSTRLHIR-ALGVTRLCVNRTPRHIYAQVISADGGKVLAQASTLDASLRSGTTGNIEAATKVGALIAERAKAAGVTKVAFDRSGFKYHGRIKALADAAREGGLEF
5O60 Chain:P ((13-127))--VRRNARLRRHARLRKKVAGTAEVPRLVVNRSARHIHVQLVNDLNGTTLAAASSIEADVRAIDGDKKAHSVRVGQLIAERAKAAGVETVVFDRGGYTYGGRIAALADAAREAGLKF


General information:
TITO was launched using:
RESULT:

Template: 5O60.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain P - contact count / total energy / energy per contact / energy per residue : 480 7703 16.05 67.57
target 2D structure prediction score : 0.69
Monomeric hydrophicity matching model chain P : 0.82

3D Compatibility (PKB) : 16.05
2D Compatibility (Sec. Struct. Predict.) : 0.69
1D Compatibility (Hydrophobicity) : 0.82
QMean score : 0.658

(partial model without unconserved sides chains):
PDB file : Tito_5O60.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5O60-query.scw
PDB file : Tito_Scwrl_5O60.pdb: