Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -------NCTANILNI-NEVVIATGC--VPAGGNLIIRVGSDHSYLIRATVSCGLSLNPSQSFIN-GESLASGGRC 1E79 Chain:A ((19-94)) ADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFGNDKLIKEGDIVKRTGAI

General information: TITO was launched using: RESULT: Template: 1E79.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 242 -3141 -12.98 -48.32 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain A : 0.68 3D Compatibility (PKB) : -12.98 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.504

(partial model without unconserved sides chains): PDB file : Tito_1E79.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1E79-query.scw PDB file : Tito_Scwrl_1E79.pdb: