Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAQSLNKTVLLSTTGTSYLSIAGKVGKFLVGDQALEFYPDVNVEQFIQIPWSHINQIGANVTGRKISRHFEVFT---D-KGKFLFASKDSGAILKIAREKLGNDKVVKLPTLIQTISQKFKNLFAKK 5EJS Chain:A ((423-492)) --------------------------WLAINKKGVSIFDPHTKESKNFWTFQSISNVAFTD-----DT-FCIMTGNLMKPIKQTFTTDEHSSIASVYQFYSS-------------------------

General information: TITO was launched using: RESULT: Template: 5EJS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 209 -26057 -124.67 -394.80 target 2D structure prediction score : 0.42 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : -124.67 2D Compatibility (Sec. Struct. Predict.) : 0.42 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.513

(partial model without unconserved sides chains): PDB file : Tito_5EJS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5EJS-query.scw PDB file : Tito_Scwrl_5EJS.pdb: