Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMQIYLNGELTDTPSQ----NLLQLIQELALEGK------RFAVEHNQQIVPKSKLEQISIAQHDRIEIIHAVGGG
3RPF Chain:C ((3-74))VEVRFFGPIKEENFFIKANDLKELRAILQEKEGLKEWLGVCAIALNDHLIDN---LNTPLKDGDVISLLPPVCGG


General information:
TITO was launched using:
RESULT:

Template: 3RPF.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 167 822 4.92 13.25
target 2D structure prediction score : 0.68
Monomeric hydrophicity matching model chain C : 0.65

3D Compatibility (PKB) : 4.92
2D Compatibility (Sec. Struct. Predict.) : 0.68
1D Compatibility (Hydrophobicity) : 0.65
QMean score : 0.597

(partial model without unconserved sides chains):
PDB file : Tito_3RPF.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3RPF-query.scw
PDB file : Tito_Scwrl_3RPF.pdb: