Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ------------MTKPPYHDDQASFSAPIEDL----QVRIAFLDDLVEE------LNQQLAIQTLEIADLKKQMQLLYQRVESADLSEGVAPFDPLTNKPPHY 5K0P Chain:A ((6-108)) KSPSLVRLKTRGESVCPISKTVDSFEVSVEYIPRGAVLAIEEFKKMVDSYRGREILHEELAVDLLEKVKAAVNPPYVKVTVKSYYIGVEVEVVAESGGVPPVY

General information: TITO was launched using: RESULT: Template: 5K0P.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 323 -3736 -11.57 -46.12 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -11.57 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.312

(partial model without unconserved sides chains): PDB file : Tito_5K0P.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5K0P-query.scw PDB file : Tito_Scwrl_5K0P.pdb: