Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MHSFVLVVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFGASGSGNFLTRVTAILTALFFVTSLTLAVFAKKQTTEAYSLKTVQTTAPAQTTSPETSPNAPKTGQ 3J45 Chain:G ((9-73)) --------FLIVAIGLVGLIMLQQGKGADMGASFGAGASATLFGSSGSGNFMTRMTALLATLFFIISLVLGNI------------------------------------

General information: TITO was launched using: RESULT: Template: 3J45.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 97 -18550 -191.24 -285.38 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain G : 0.78 3D Compatibility (PKB) : -191.24 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.78 QMean score : 0.112

(partial model without unconserved sides chains): PDB file : Tito_3J45.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3J45-query.scw PDB file : Tito_Scwrl_3J45.pdb: