Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMFTGCQNMSPSDQRIGAAAAGGALG-----GGLGNHVGGGIGAGLGAAVGAGVGSNTQGGSKQTTTKSAIGAGIGSVVGKAIIGSDTGAAIGGAIGGGAGAAIEEKK----
2Q97 Chain:T ((1-109))MQQELGLLRPEERLIAGQAKAAALQTVHQLGAVALTPEQAKAALLDEILRATQNLDLRKYENLNTEQQKAYEQVQRDLSQ--LSPETKALLIENQRKEKTLLEKARKLFQR


General information:
TITO was launched using:
RESULT:

Template: 2Q97.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain T - contact count / total energy / energy per contact / energy per residue : 47 1376 29.28 13.76
target 2D structure prediction score : 0.63
Monomeric hydrophicity matching model chain T : 0.65

3D Compatibility (PKB) : 29.28
2D Compatibility (Sec. Struct. Predict.) : 0.63
1D Compatibility (Hydrophobicity) : 0.65
QMean score : -0.190

(partial model without unconserved sides chains):
PDB file : Tito_2Q97.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2Q97-query.scw
PDB file : Tito_Scwrl_2Q97.pdb: