Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence----------MLNIIS----TNKAPNFQYTDEMDRFLMNTLAFSVGLVTEDYSTFDPEVLKIMEEEPDWLQESVAWCQSLVVGSLVDSGNYDDTGELMDEFN---------CLLNLYDRARQRELTSNEDNLFLNIHD----------KFLALLLTDDELITNLLEVE----------------
4LEU Chain:A ((71-252))KLIGKEALFVILGLKRLKEDDEKLDKFIKTHVFRLLKLDMLAVIGELERQEETALAIKMFEVIQK-QEWYQPDVFMYKDLIV-SLAKSKRMDEAMALWEKMKKENLFPDSQTYTEVIRGFLRDGCPADAMNVYEDMLKSPDPPEELPFRVLLKGLLPHPLLRNKVKKDFEELFPEKHAYDPPEE


General information:
TITO was launched using:
RESULT:

Template: 4LEU.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 546 23534 43.10 176.95
target 2D structure prediction score : 0.56
Monomeric hydrophicity matching model chain A : 0.71

3D Compatibility (PKB) : 43.10
2D Compatibility (Sec. Struct. Predict.) : 0.56
1D Compatibility (Hydrophobicity) : 0.71
QMean score : 0.328

(partial model without unconserved sides chains):
PDB file : Tito_4LEU.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4LEU-query.scw
PDB file : Tito_Scwrl_4LEU.pdb: