Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-----------PGNRGSKLSPISSSISSPESLSDEEFEKFC----CVYIVNLGKPD-QREWPVLTGKEVWFEHKRKKYDVMAFDSCNLVWGRRGEPKGVTFEFLETRTANKDGTC-----------------------------------------------------------------------------------------------------------------------------------------------------------------
5L2X Chain:A ((1-348))MNRKWEAKLKQIEERASPEEPPSIWRLFHRQAQAFNFVKSCKEDVHVFALECKVGDGQRIYLVTTYAEFWFYYKSRKNLLHCYEVIP-----ENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCKALQELYGVNCSAEDVLNLDSSTDEKFSRHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLPDLSFLVVKNNMGEKHLFVDLGVYTRNRNFRLYKSSKIGKRVALEVTEDNKFFPIQSKDVSDEYQYFLSSLVSNVRFSDTLRILTCEP


General information:
TITO was launched using:
RESULT:

Template: 5L2X.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 257 3273 12.73 34.81
target 2D structure prediction score : 0.64
Monomeric hydrophicity matching model chain A : 0.56

3D Compatibility (PKB) : 12.73
2D Compatibility (Sec. Struct. Predict.) : 0.64
1D Compatibility (Hydrophobicity) : 0.56
QMean score : 0.299

(partial model without unconserved sides chains):
PDB file : Tito_5L2X.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5L2X-query.scw
PDB file : Tito_Scwrl_5L2X.pdb: