Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSTTSSATTPIEINALGQPCPMPLLMLKRELKKLSGKQLFLLKSSDPHSEIDVTRYCQLHHFTCQTMQISEREFHYLIETQ 1FD8 Chain:A ((6-30)) ---------HYQFNV-VMTCSGCSGAVNKVLTKLE----------------------------------------------

General information: TITO was launched using: RESULT: Template: 1FD8.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 16 -4191 -261.91 -167.62 target 2D structure prediction score : 0.84 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -261.91 2D Compatibility (Sec. Struct. Predict.) : 0.84 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.611

(partial model without unconserved sides chains): PDB file : Tito_1FD8.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1FD8-query.scw PDB file : Tito_Scwrl_1FD8.pdb: