Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKLTKQQRAELKQKFGGHCAYCGDLLG-DKWHADHIEAVKRDLIHVGGGKLITGEMTRPQN-DTLENMNPACVPCNKNKSSMPLEGWRKLLTHYRDVQLLRDSTHAHHLLRFGLIEIKTKPVTFFFENYKGASHE 4OGE Chain:A ((552-620)) ----DIVRLDALELQGCACLYCGTTIGYHTCQLDHIVPQA-----------------GPGSNNRRGNLVAVCERCNRSKSNTPFAVW------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4OGE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 211 -5530 -26.21 -86.40 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -26.21 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.331

(partial model without unconserved sides chains): PDB file : Tito_4OGE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4OGE-query.scw PDB file : Tito_Scwrl_4OGE.pdb: