Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVNHQIKVLQALASAIAEGGRGVTGTAFPKQPVRALKLYEFEGSPFCRRIREVITLLNLDGLCCTNLLKADFTKSYQIQGTTRV 5J0K Chain:A ((6-79)) ---TRTEIIRELERSLREQEEL---AKRLKELLRELERLQREGSS----DEDVRELLREIKELVEEIEKLAREQKYLVEELKRQ

General information: TITO was launched using: RESULT: Template: 5J0K.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 119 -4958 -41.66 -67.00 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -41.66 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.286

(partial model without unconserved sides chains): PDB file : Tito_5J0K.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5J0K-query.scw PDB file : Tito_Scwrl_5J0K.pdb: