Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------------------------MGITPMYVCLCRGITDQDIKDAIENGAESYREIRDLLDLGTCCG-----RCAPEARAIISEELAEIAARISVAA 1W9G Chain:A ((1-102)) MSHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRM-NPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQA

General information: TITO was launched using: RESULT: Template: 1W9G.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 166 -11911 -71.75 -175.15 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -71.75 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.327

(partial model without unconserved sides chains): PDB file : Tito_1W9G.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1W9G-query.scw PDB file : Tito_Scwrl_1W9G.pdb: