Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MALTEKKKAFALAKRNGKDNKEAAILAGCPEKTASAAGARLAKDPDVIAYLERLEEATPEQAVKHEVKPLTTFTSIQTANKLDDPLEFLKSVYTDQVEDMALRVRAAQAALPYVHGKVAEKGKKETKEDAAKAATKTGKFGTLNNQLPS 1FSE Chain:B ((12-44)) --LTKREREVFELLVQDKTTKEIASELFISEKTVR------------------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1FSE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 78 -4236 -54.30 -128.35 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain B : 0.59 3D Compatibility (PKB) : -54.30 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.900

(partial model without unconserved sides chains): PDB file : Tito_1FSE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1FSE-query.scw PDB file : Tito_Scwrl_1FSE.pdb: