Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--MTTEHFDLANPVTKVDDIPDYEMYSQTIDSLNKRFGNRVLKGIKIGYIASEKDRIIDYLADKDYDLKLLSVHHNGQFDYLDDEVKDMDPAIVIPQYFAQLSEALVVIEADVFA-----HFDYGFRVF-----GLSVAEFKQYEAQFLPILDQVIKNKLAFEL--NAKSAYLYDNLALY---------EYVIDLCLSRGGTLF--
5MLC Chain:L ((55-250))TKCTEEWRQLKEAVKKEFAIPHVPLDQRWMFTLEEATGPDIWN--TTWYPKSADHVPTDK---KWYVVDATDLILGRMASTIAIHIRGKNLASYTPSV--DMGAFVIVVNADKVAVSGKKRTQKLYRRHSGRPGGLKEETFDQLQKR---IPERIIEHAVRGMLPKGRLGRYLFNHLKVYKGAEHPHQAQQPIDLPLRDKRIRVEK


General information:
TITO was launched using:
RESULT:

Template: 5MLC.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain L - contact count / total energy / energy per contact / energy per residue : 518 7252 14.00 42.41
target 2D structure prediction score : 0.27
Monomeric hydrophicity matching model chain L : 0.68

3D Compatibility (PKB) : 14.00
2D Compatibility (Sec. Struct. Predict.) : 0.27
1D Compatibility (Hydrophobicity) : 0.68
QMean score : 0.141

(partial model without unconserved sides chains):
PDB file : Tito_5MLC.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5MLC-query.scw
PDB file : Tito_Scwrl_5MLC.pdb: