Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKRNYLVISIIALSVLLFFEITSVASLITEVKGQTHSSEHSSQSFKQSEQSTIKSQSTETANVKEAIQESAEKVQSQSSQSTQDSTEAIQDPTVKSVAISFDDGPGATTTPQLLRILKEKTCMSLFSS 2IW0 Chain:A ((34-74)) --------------------------------------------------------------------------------------PILQCTQPGLVALTYDDGPFTFT-PQLLDILKQNDVRATFFV

General information: TITO was launched using: RESULT: Template: 2IW0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 63 -11803 -187.34 -287.87 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : -187.34 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.500

(partial model without unconserved sides chains): PDB file : Tito_2IW0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2IW0-query.scw PDB file : Tito_Scwrl_2IW0.pdb: