Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence DPKNCKFNVLNGSGINVANGCCDVTKKQVTVSP----FTVSCTESCGLAIVSGGDPT--FSLQNAGRC 2MM2 Chain:A ((1-65)) ---NCTANILNINEVVIATGCVPAGGNLIIRVGSDHSYLIRATVSCGLSLNPSQSFINGESLASGGRC

General information: TITO was launched using: RESULT: Template: 2MM2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 242 -21289 -87.97 -360.83 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain A : 0.74 3D Compatibility (PKB) : -87.97 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.503

(partial model without unconserved sides chains): PDB file : Tito_2MM2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2MM2-query.scw PDB file : Tito_Scwrl_2MM2.pdb: