Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceTQKCIITIRKADPALGQ---------DTLYDLVSLAPNSDLTFGKIPASMTEVTFGVDEKCQARLVRGD----LSRPYEYKGMQNPLYGLDGPDFVKK------------LQAWRRKPENSINFSLW
4DID Chain:B ((16-142))ARPEIIVLREPGATWGNYLQHQKASNHSLHNLYNLQRDLLTVAATVLGKQDPVLTSMANQMELAKVKADRPATKQEEAAAKALKKNLIELIAARTQQQDGLPAKEAHRFAAVAFRDAQVKQLNNQPW


General information:
TITO was launched using:
RESULT:

Template: 4DID.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 252 21935 87.04 215.05
target 2D structure prediction score : 0.44
Monomeric hydrophicity matching model chain B : 0.71

3D Compatibility (PKB) : 87.04
2D Compatibility (Sec. Struct. Predict.) : 0.44
1D Compatibility (Hydrophobicity) : 0.71
QMean score : 0.215

(partial model without unconserved sides chains):
PDB file : Tito_4DID.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4DID-query.scw
PDB file : Tito_Scwrl_4DID.pdb: