Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence SLLSTISNDKCFVSSYKFTPDGRKVIEASQAAPGDGPITFTSTRDNFHMTIQIDANCAPRNPDDIQKELPSHRGFDFYTKAHNLPGLNPRHN 1Z5S Chain:D ((2629-2693)) ------SLDVLIVYELTPTAEQKALATKLKLPP--------------------TFFCYKNRPDYVSEEEEDDEDFETAVKKLN-GKLYLDGS

General information: TITO was launched using: RESULT: Template: 1Z5S.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 78 2854 36.59 43.91 target 2D structure prediction score : 0.46 Monomeric hydrophicity matching model chain D : 0.60 3D Compatibility (PKB) : 36.59 2D Compatibility (Sec. Struct. Predict.) : 0.46 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.256

(partial model without unconserved sides chains): PDB file : Tito_1Z5S.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Z5S-query.scw PDB file : Tito_Scwrl_1Z5S.pdb: