Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence YGDCFIGL--YEKGGRNPNH--IAGTEADES-GTFEVLHENYKIRVKIFKCVKQHVYDSTPSGTEIRVIPSVGYDPNKRQTAPRPAPRPAPRPAPRRTQNAAGHR 1OQK Chain:A ((9-86)) -RHELIGLSVRIARSVHRDIQGISGRVVDETRNTLRIEMDDGR-EITVPKGIAVFHFR-TPQGELVEI-------DGRALVA---------RPEERI--------

General information: TITO was launched using: RESULT: Template: 1OQK.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 311 28863 92.81 395.38 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : 92.81 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.393

(partial model without unconserved sides chains): PDB file : Tito_1OQK.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1OQK-query.scw PDB file : Tito_Scwrl_1OQK.pdb: