Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ----KCVIKRVFSDGSSVKIPAQPAQSTTISKQAVWVYGNCQPFPVVLNDGSKLS--------GEIETPA--VTPVES- 3JB9 Chain:H ((9-84)) MIPPINFIFKLLQQHTPVSIWLFEQTDIRLQG---QIRGFDEFMNIVLDDAVQVDAKNNKRELGRILLKGDNITLIQAI

General information: TITO was launched using: RESULT: Template: 3JB9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 152 3008 19.79 49.31 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain H : 0.68 3D Compatibility (PKB) : 19.79 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.244

(partial model without unconserved sides chains): PDB file : Tito_3JB9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3JB9-query.scw PDB file : Tito_Scwrl_3JB9.pdb: