Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWYHGAIPRAEVAELLV---HSGDFLVRESQGKQ-EYVLSVLWDGLPRHF-IIQSLDNLYRLEGEGFPSIPLLIDHL
1CJ1 Chain:L ((4-78))WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDY-


General information:
TITO was launched using:
RESULT:

Template: 1CJ1.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain L - contact count / total energy / energy per contact / energy per residue : 229 5611 24.50 80.15
target 2D structure prediction score : 0.54
Monomeric hydrophicity matching model chain L : 0.73

3D Compatibility (PKB) : 24.50
2D Compatibility (Sec. Struct. Predict.) : 0.54
1D Compatibility (Hydrophobicity) : 0.73
QMean score : 0.464

(partial model without unconserved sides chains):
PDB file : Tito_1CJ1.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1CJ1-query.scw
PDB file : Tito_Scwrl_1CJ1.pdb: