Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAQSLNKTVLLSTTGTSYLSIAGKVGKFLVGDQALEFYPDVNVEQFI-QIPWSHINQIGANVTGRKISRHFEVFTD--KGKFLFASKDSGAILKIAREKLGNDKVVKLPTLIQTISQKFKNLFAKK 4HDO Chain:A ((243-313)) ------------------------PVYVGVNIKGLHLLNMET-KALLISLKYGCFM--WQL-GD-TDTC-FQIHSMENKMSFIVHTKQAGLVVKLLMKLNG-------------------------

General information: TITO was launched using: RESULT: Template: 4HDO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 231 -9361 -40.52 -137.66 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain A : 0.59 3D Compatibility (PKB) : -40.52 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.663

(partial model without unconserved sides chains): PDB file : Tito_4HDO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4HDO-query.scw PDB file : Tito_Scwrl_4HDO.pdb: