Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGTAMNVKNQAQDRQQILIDLYKQYLLSEITLGQLLSYLRKNVLGLSQEQYANLVGISRRTLTDIEQDKGKLTQSVLDKVFKPLGLKAGLVPTHEHIVSKIIKPNE 3IVP Chain:C ((12-77)) ------------------------------ALGLAIKEARKK-QGLTREQVGAMIEIDPRYLTNIENKGQHPSLQVLYDLVSLLNVSVDEFFLPASS---------

General information: TITO was launched using: RESULT: Template: 3IVP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 219 -38497 -175.78 -583.28 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain C : 0.65 3D Compatibility (PKB) : -175.78 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.65 QMean score : 0.729

(partial model without unconserved sides chains): PDB file : Tito_3IVP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3IVP-query.scw PDB file : Tito_Scwrl_3IVP.pdb: