Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLRLKCLGGPLYGQEYSHAGDEFLFNDKQSGKQTLYRKQTLDFTPPQDVFVAESISNIIAYNLALQLKK---------------------------------------- 4G2S Chain:A ((6-111)) PYIVRLLNSSLNGCEFPLLTGRTLFVV---GQSDALTASGQLPDIPADSFFIPLDHGGVNFEIQVDTDATEIILHELKEGNSESRSVQLNTPIQVGELLILIRPESEPW

General information: TITO was launched using: RESULT: Template: 4G2S.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 200 -23700 -118.50 -359.08 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -118.50 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.403

(partial model without unconserved sides chains): PDB file : Tito_4G2S.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4G2S-query.scw PDB file : Tito_Scwrl_4G2S.pdb: