Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence ---MHSFVLVVHIILAVLMIALILVQHGKGADAGASFGGGGAATVFGASGSGNFLTRVTAILTALFFVTSLTLAVFAKKQTTEAYSLKTVQTTAPAQTTSPETSPNAPKTGQ 5AWW Chain:G ((1-75)) MDLLYTLVILFYLGVAGLLVYLVLVQEPK---QGAGDLMGGSADLFSARGVTGGLYRLTVILGVVFAALALVIGLWPR----------------------------------

General information: TITO was launched using: RESULT: Template: 5AWW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 95 -29137 -306.70 -404.67 target 2D structure prediction score : 0.83 Monomeric hydrophicity matching model chain G : 0.75 3D Compatibility (PKB) : -306.70 2D Compatibility (Sec. Struct. Predict.) : 0.83 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.221

(partial model without unconserved sides chains): PDB file : Tito_5AWW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5AWW-query.scw PDB file : Tito_Scwrl_5AWW.pdb: