Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------MIQRISHHDLEHVYATAVNTIQSQMNFQDAVAQLEEVARAGHGKAALFLAELYYQGFRVERDSMKAQYWQKLATMQA-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------
5JJO Chain:A ((4-268))LRPFICVNEKDHLPSLDPQADAWYREAVALAKPDTLRPWDRIVDLYSKAVERGHWKAMHNLASLYRTGWKDTQKALDL--YQKMIDLKVPQGFYDMAAMIGNRAGVKNPATDGLTFLDKAASLGNPPALTELGRLYIYVAGQDELGLKYTNCAAGQGYAPANYELAMYYRLVAHNYPKAAGYYLLAASQGNDDAAFFMSGVFDKTSPDVDRMWYAPDEKLHKLYDGIYDQLAADPDLRFPNLIKDHPLPPHPTQGYDADRPD


General information:
TITO was launched using:
RESULT:

Template: 5JJO.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 213 -7304 -34.29 -97.38
target 2D structure prediction score : 0.81
Monomeric hydrophicity matching model chain A : 0.55

3D Compatibility (PKB) : -34.29
2D Compatibility (Sec. Struct. Predict.) : 0.81
1D Compatibility (Hydrophobicity) : 0.55
QMean score : 0.375

(partial model without unconserved sides chains):
PDB file : Tito_5JJO.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5JJO-query.scw
PDB file : Tito_Scwrl_5JJO.pdb: