Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGVVMACKGCEERREWIKQQYQLFKERLQLRKQRDTSTANPDSGAEYNTDSASSTKGSSDIGSTGTEQ 3MQP Chain:B ((1-25)) ----------AELEVECATQLRRFGDKLNFRQKLL---------------------------------

General information: TITO was launched using: RESULT: Template: 3MQP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 4 323 80.75 12.92 target 2D structure prediction score : 0.88 Monomeric hydrophicity matching model chain B : 0.59 3D Compatibility (PKB) : 80.75 2D Compatibility (Sec. Struct. Predict.) : 0.88 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.581

(partial model without unconserved sides chains): PDB file : Tito_3MQP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3MQP-query.scw PDB file : Tito_Scwrl_3MQP.pdb: