Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------------ESCLVYYFQPDGSSVQKVQDVGDKITRYLAHAYN----GSQ----KYEATINEGCKLS-------GKFPDEI-------KVV----VMPIRV---- 1ENF Chain:A ((101-212)) EKLAQERVIGANVWVDGIQKETELIRTNKKNVT-LQELDIKIRKILSDKYKIYYKDSEISKGLIEFDMKTPRDYSFDIYDLKGENDYEIDKIYEDNKTLKSDDISHIDVNLYT

General information: TITO was launched using: RESULT: Template: 1ENF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 162 5885 36.33 90.54 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : 36.33 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.443

(partial model without unconserved sides chains): PDB file : Tito_1ENF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1ENF-query.scw PDB file : Tito_Scwrl_1ENF.pdb: