Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence KCNISILKDGKYFTQKQE---IAGWTVKFHDLD------GN--YV-----GKCKNAHTYACTYVTCEDLAPGYSPGKSKDVVA-----SGNVGSLGHDPSSSS------PSSP----------------------- 1HTP Chain:? ((1-131)) ----SNVLDGLKYAPSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEPGVSVTKGKGFGAVESVKATSDVNSPISGE-VIEVNTGLTGKPGLINSSPYEDGWMIKIKPTSPDELESLLGAKEYTKFCEEEDAAH

General information: TITO was launched using: RESULT: Template: 1HTP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 325 26790 82.43 330.73 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain A : 0.63 3D Compatibility (PKB) : 82.43 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.63 QMean score : 0.273

(partial model without unconserved sides chains): PDB file : Tito_1HTP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1HTP-query.scw PDB file : Tito_Scwrl_1HTP.pdb: