Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence GCKVELLNFNSVAVGTGCVPFNYYASIYDPNTRAGYTIHATNDCGLSVQAGQRLPENYSLRKAGFC M037 Chain:A ((1-66)) GCKVELLNFNSVAVGTGCVPFNYYASIYDPNTRAGYTIHATNDCGLSVQAGQRLPENYSLRKAGFC

General information: TITO was launched using: RESULT: Template: M037.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 300 -44567 -148.56 -675.26 target 2D structure prediction score : 0.62 Monomeric hydrophicity matching model chain A : 1.00 3D Compatibility (PKB) : -148.56 2D Compatibility (Sec. Struct. Predict.) : 0.62 1D Compatibility (Hydrophobicity) : 1.00 QMean score : 0.400

(partial model without unconserved sides chains): PDB file : Tito_M037.pdb: (Unconserved sides chains are recalculated) : Sequence: align-M037-query.scw PDB file : Tito_Scwrl_M037.pdb: