Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAANYLKAMQSYLKETDLPKLEQLVVTKSWWDTVDILDRVV-GSLVYEHPEL-EEIIL--ILFENLFKPRQLYLQPQNSVLSNLRLAS 3JX7 Chain:A ((80-153)) AALDIMQKYKKHINETHIPFLEELIVTKSWWDSVDSIVPTFLGDIFLKHPELISAYIPKWIASDNIWLQRAAIL--------------

General information: TITO was launched using: RESULT: Template: 3JX7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 171 -24193 -141.48 -345.61 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.76 3D Compatibility (PKB) : -141.48 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.76 QMean score : 0.339

(partial model without unconserved sides chains): PDB file : Tito_3JX7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3JX7-query.scw PDB file : Tito_Scwrl_3JX7.pdb: