Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAQQRRGGFKRRKKVDYIAANKIEYVDYKDTELLSRFVSE-RGKILPRRVTGTSAKNQRKVTTAIKRARVMALMPFVNED 5AJ3 Chain:R ((56-127)) -----ENPYKEPLKKCILCEK---HVDYKNVQLLSQFISPFTGCIYGRHITGLCGKKQKEITKAIKRAQILGFMPVTYKD

General information: TITO was launched using: RESULT: Template: 5AJ3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain R - contact count / total energy / energy per contact / energy per residue : 222 -10780 -48.56 -151.82 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain R : 0.84 3D Compatibility (PKB) : -48.56 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.84 QMean score : 0.466

(partial model without unconserved sides chains): PDB file : Tito_5AJ3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5AJ3-query.scw PDB file : Tito_Scwrl_5AJ3.pdb: