Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------MSSTQ-FDHVTVIKKSNVYFGGACISHTVQFEDGTKKTLGVILPTEQPLTFE-THVPERMEIISGECRVKIADSNESELFRAGQSFY-VPG-NSVFKIETDEVLDYVCHLEG
3BCW Chain:A ((5-122))HDKSRLVRIDTGPMINPVAGKPSRPIAGDASFRTVTAFEGGQGKVESGVWESTSGSFQSNTTGYIEYCHIIEGEARLV-DPDGTVHAVKAGDAFIMPEGYTGRWEVDRHVKKIYFVTHL-


General information:
TITO was launched using:
RESULT:

Template: 3BCW.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 371 4041 10.89 38.12
target 2D structure prediction score : 0.58
Monomeric hydrophicity matching model chain A : 0.64

3D Compatibility (PKB) : 10.89
2D Compatibility (Sec. Struct. Predict.) : 0.58
1D Compatibility (Hydrophobicity) : 0.64
QMean score : 0.405

(partial model without unconserved sides chains):
PDB file : Tito_3BCW.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3BCW-query.scw
PDB file : Tito_Scwrl_3BCW.pdb: