Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKPDISELSVEELKRLQEEAEALIASKKDQAIEDAYNQIIEIAENVGFSVEQLLEFGAQKRKKTTRKSVEPRYRNKNNAEETWTGRGKQPRWLVAEIEKGAKLEDFLI 2L92 Chain:A ((72-105)) -------------------------------------------------------------------STVPKYRDPAT-GKTWSGRGRQPAWLGN------DPAAFLI

General information: TITO was launched using: RESULT: Template: 2L92.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 84 -1926 -22.93 -56.65 target 2D structure prediction score : 0.91 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : -22.93 2D Compatibility (Sec. Struct. Predict.) : 0.91 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.786

(partial model without unconserved sides chains): PDB file : Tito_2L92.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2L92-query.scw PDB file : Tito_Scwrl_2L92.pdb: