Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--------------------------------------------------------------KLCKWTVLNSEGEIIESGSCLN-TEYMKHGDIHVEFENDCTPIIFGADL---VAEKVTIKGEIEEVLGCE----------------------------------------------------------------------------------------------
3GF6 Chain:A ((4-222))DAIYYPVGDVDIERGGPALEVGEEDVLVARSFNEEDYVLDTIAQYPNDPTLGKLTFMIDLKNQQKDQNVADFNGV---GKSKLTMSLGYKDGNYP---SESQVPIYTSQDVTAKYAVKLRLKGELL-VSGDEWMIDYVYAQLASLFQPYPPANFPEVFMCKGGMKLGTFDSFRRTCTFDITYDRSDLSFSQLYFNLFINLAGQKRENRVRLRIDKESYFELYEQSE


General information:
TITO was launched using:
RESULT:

Template: 3GF6.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 27 -970 -35.91 -16.43
target 2D structure prediction score : 0.42
Monomeric hydrophicity matching model chain A : 0.55

3D Compatibility (PKB) : -35.91
2D Compatibility (Sec. Struct. Predict.) : 0.42
1D Compatibility (Hydrophobicity) : 0.55
QMean score : 0.076

(partial model without unconserved sides chains):
PDB file : Tito_3GF6.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3GF6-query.scw
PDB file : Tito_Scwrl_3GF6.pdb: