Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLKDKEPGSFIVRDSHSFRGAYGLAMKVATPPPSVLQLNKKAGDLANELVRHFLIECTPKGVRLKGCSNEPYFGSLTALVCQH 2VIF Chain:A ((40-103)) -LANVPDGSFLVRDSSDDRYLLSLSFRSH------------------GKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHS

General information: TITO was launched using: RESULT: Template: 2VIF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 208 -32522 -156.35 -508.15 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -156.35 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.256

(partial model without unconserved sides chains): PDB file : Tito_2VIF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2VIF-query.scw PDB file : Tito_Scwrl_2VIF.pdb: