Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------MLNLQFAETMELTEAELQDV-----RGGNLVNSMGGGGRSGISGWGVPGIYPGWGNQGMSPNRGAFDWTIDLADGL-FGRRRR
3FN2 Chain:A ((6-102))YTMQRDNQKTLAVYMFEEINRDVEYLSGRLSEKELKDKYRYYGRGYVRITDKDGQVITYEDG-SVQDKTVFLTNEGANKLGWKLEFLID---EKMFEEEIL


General information:
TITO was launched using:
RESULT:

Template: 3FN2.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 81 3626 44.76 49.66
target 2D structure prediction score : 0.60
Monomeric hydrophicity matching model chain A : 0.56

3D Compatibility (PKB) : 44.76
2D Compatibility (Sec. Struct. Predict.) : 0.60
1D Compatibility (Hydrophobicity) : 0.56
QMean score : 0.126

(partial model without unconserved sides chains):
PDB file : Tito_3FN2.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3FN2-query.scw
PDB file : Tito_Scwrl_3FN2.pdb: