Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKLKKEKKMAEFTFEIEEHLLTLSENEKGWTKEINRVSFNGAPAKFDIRAWSPDHTKMGKGITLSNE-EFQTMVDAFKGN 1FSV Chain:A ((1-28)) ----------------------------------------------------QQYTAKIKGRTFRNEKELRDFIEKFKGR

General information: TITO was launched using: RESULT: Template: 1FSV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 55 348 6.33 12.89 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : 6.33 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.592

(partial model without unconserved sides chains): PDB file : Tito_1FSV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1FSV-query.scw PDB file : Tito_Scwrl_1FSV.pdb: