Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLLKFTEDAWADYCYWQNQDKKTLKRINKLI-KDIQRDPFTGIGKPEPLKYDYQGAWSRRIDAENRLIYMMDGD--SVAFLSFKDHY 3G5O Chain:B ((18-96)) YTVRFTTTARRDLHKLPPR---ILAAVVEFAFGDLSREPLRV-G--KPLRRELAGTFSARRG-TYRLLYRIDDEHTTVVILRVDHR-

General information: TITO was launched using: RESULT: Template: 3G5O.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 290 -13630 -47.00 -179.34 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain B : 0.74 3D Compatibility (PKB) : -47.00 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.74 QMean score : 0.685

(partial model without unconserved sides chains): PDB file : Tito_3G5O.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3G5O-query.scw PDB file : Tito_Scwrl_3G5O.pdb: